SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028106 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028106
Domain Number 1 Region: 397-497
Classification Level Classification E-value
Superfamily E set domains 3.34e-26
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 185-243
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000181
Family B-box zinc-binding domain 0.0033
Further Details:      
 
Domain Number 3 Region: 26-59,94-102
Classification Level Classification E-value
Superfamily RING/U-box 0.000000402
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028106
Domain Number - Region: 226-327
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00301
Family Apolipoprotein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028106   Gene: ENSGGOG00000014996   Transcript: ENSGGOT00000034298
Sequence length 580
Comment pep:known_by_projection chromosome:gorGor3.1:1:120213649:120223167:-1 gene:ENSGGOG00000014996 transcript:ENSGGOT00000034298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENRKPLLGIVSKLPSGTALGNSGKTHCPLCLGLFKAPRLLPCLHTVCTTCLEQLEPFS
VVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVND
VMLESLRGEGQGLVCDLCNDREVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLK
GYSRIGKPILCPVHPAEELRLFCEFCDRPVCRDCVVGEHREHPCDFTSNVIHKHGDSVRE
LLKGTQPHVEALEEALAQIHIMNSALQKRVEAVAADVRTFSEGYIKAIEEHRDKLLKQLE
DIRAQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKGVVVERLRKLNKV
QYSARPGVNDKIRFCPQEKAGQCHGYEIYGTINTKELDPAKCVLQGEDLHRAREKQTASF
TLLCKDAAGEIMGRGGDNVQVAIVPKDKKDSPVRTVVQDNKDGTYYISYTPKEPGVYTVW
VCIKEQHVQGSPFTVTVRRKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHG
HKGHPGHPHWSCCGKFNEKSECTWTGGQSAPRSLLRTVAL
Download sequence
Identical sequences G3SJ16
XP_004026475.1.27298 ENSGGOP00000028106 ENSGGOP00000028106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]