SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028146 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028146
Domain Number 1 Region: 88-270
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-58
Family SPRY domain 0.000000232
Further Details:      
 
Domain Number 2 Region: 7-76
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000786
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028146   Gene: ENSGGOG00000025780   Transcript: ENSGGOT00000029456
Sequence length 286
Comment pep:novel chromosome:gorGor3.1:19:53281753:53283143:1 gene:ENSGGOG00000025780 transcript:ENSGGOT00000029456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHFKQASSCPICLDYLENPMHLKCGYIFCLRCMNSLRKGPDGKGVLCPFCPVVSQKND
TRPAAQLGALVSKIKELEPKLRAVLQMNPRMRKFQVDMTFDVDTANNYLLISEDLRRVRC
GDFRQNRKEQAERFDSALCALGAPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVL
SSELGFWTVGLREGQIYFASTKLVTGLWVSPGLHRVGIYLDIKMRAISFYNVSDRSQSFT
FTKISATEPLRPCFAHADTSRDDHGYLSVCVINNGSASSPIYPARQ
Download sequence
Identical sequences ENSGGOP00000028146 ENSGGOP00000028146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]