SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028202 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028202
Domain Number 1 Region: 23-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-35
Family Laminin G-like module 0.000000125
Further Details:      
 
Domain Number 2 Region: 223-397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000515
Family Laminin G-like module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028202   Gene: ENSGGOG00000025587   Transcript: ENSGGOT00000025670
Sequence length 405
Comment pep:known_by_projection chromosome:gorGor3.1:17:7834028:7837293:1 gene:ENSGGOG00000025587 transcript:ENSGGOT00000025670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRGPLATSRLLLSLLLLLLLLLRHTCQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIA
VMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLT
VGAGPRLDDGRWHQVEVKMEGDSVLLKVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLF
PASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNL
RDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLD
LPLVLGLPLQLKLSMSRVVLGQGSKMEVLALPPLGLAPLLNLWAKPQGRLFLGALPGEDS
STSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDTSH
Download sequence
Identical sequences G3SJB2
XP_004058546.1.27298 ENSGGOP00000028202 ENSGGOP00000028202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]