SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028242 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028242
Domain Number 1 Region: 544-798
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.31e-84
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 11-233
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.54e-70
Family Eukaryotic proteases 0.00085
Further Details:      
 
Domain Number 3 Region: 419-517
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 4 Region: 286-394
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-19
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028242   Gene: ENSGGOG00000008697   Transcript: ENSGGOT00000030465
Sequence length 798
Comment pep:known_by_projection chromosome:gorGor3.1:12:29828842:29885175:-1 gene:ENSGGOG00000008697 transcript:ENSGGOT00000030465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSKETAVGSRFFSRISSWRNSTVTGHPWQVSLKSDEHRFCGGSLIQEDRVVTAAHCLDS
LSEKQLKNITVTSGEYSLFQKDKQEQNIPVSKIITHPEYNSREYMSPDIALLYLKHKVKF
GNAVQPICLPDSDDKVEPGILCLSSGWGKISKTSEYSNVLQEMELPIMDDRACNTVLKSM
NLPPLGRTMLCAGFPDGGMDACQGDSGGPLVCRRGGGIWILAGITSWVAGCAGGSAQTAT
DSPLVLDVKGLFTAPLQLLQVWIGANPSQKWAQTSLYKEDCKPQGTVLFGESGKIRYPHS
KGDYYSHNCLYVWKIMVPEDKIILIKFTSLDMEKQVGCDHDYVSLRSSSGVLFSKVCGKI
LPSPLLAETSEAMVPFVSDTEDSGSGLELTFTAVQNFPNASTGSGCGSPAILVEEEINHS
AKYPDLYPSNIRCHWFICAPEKHIIKLTFEDFAVKFSPNCIYDAVVIYGDSEEKHKLAKL
CGMLTITSIFSSSNMTVIYFKSDGKNRLQGFKARFTILPSESLNKFEPKLPPQNNPVSTV
KAILHDVCGIPPFSPQWLSRRIAGGEEACPHCWPWQVGLRFLGDYQCGGAIINPVWILTA
AHCVQLKNNPLSWTIIAGDHDRNLKESTEQVRRAKHIIVHEDFNTLSYDSDIALIQLSSP
LEYNSVVRPVCLPHSAEPLFSSEICAVTGWGLGIENGGLASRLQQIQVHVLEREVCEHSY
YSAHPGGITEKMICAGFAASGEKDFCQGDSGGPLVCRHENGPFVLYGIVSWGAGCVQPWK
PGIFARVMIFLDWIQSKI
Download sequence
Identical sequences ENSGGOP00000028242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]