SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028251 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028251
Domain Number 1 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000119
Family CCCH zinc finger 0.0046
Further Details:      
 
Domain Number 2 Region: 38-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000445
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028251
Domain Number - Region: 120-142
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0062
Further Details:      
 
Domain Number - Region: 146-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00183
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number - Region: 92-117
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.089
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028251   Gene: ENSGGOG00000026659   Transcript: ENSGGOT00000023341
Sequence length 179
Comment pep:known_by_projection chromosome:gorGor3.1:5:10100770:10115240:1 gene:ENSGGOG00000026659 transcript:ENSGGOT00000023341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHD
RGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECPFLHVKPAFK
SQDCPWYDQGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAQKIWEFKLLPGSKI
Download sequence
Identical sequences G3SJG1
XP_004041119.1.27298 ENSGGOP00000028251 ENSGGOP00000028251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]