SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028276 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028276
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.42e-17
Family THAP domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028276   Gene: ENSGGOG00000025383   Transcript: ENSGGOT00000026696
Sequence length 309
Comment pep:known_by_projection chromosome:gorGor3.1:22:4871234:4873554:-1 gene:ENSGGOG00000025383 transcript:ENSGGOT00000026696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEY
IYFCSKHFEENCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPPEVSRL
RRCRKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSDLLG
PLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGSALLW
KRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQERAREKRAQADARQTLKEHVQDF
AMQLSSSMA
Download sequence
Identical sequences A0A2K5XUS8 A0A2K6CAZ2 G3SJI6 G7PHA3 H2QLA4 H9ZDW3
ENSGGOP00000028276 ENSMMUP00000026977 ENSMMUP00000026977 ENSPTRP00000024282 ENSPTRP00000024282 ENSGGOP00000028276 NP_001248519.1.72884 XP_001168129.1.37143 XP_003806939.1.60992 XP_004063122.1.27298 XP_005567967.2.63531 XP_011738084.1.29376 XP_011842725.1.47321 XP_015005231.1.72884 XP_016795252.1.37143 9544.ENSMMUP00000026977 9598.ENSPTRP00000024282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]