SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028278 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028278
Domain Number 1 Region: 48-128
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000121
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 305-351
Classification Level Classification E-value
Superfamily RING/U-box 0.000000121
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 248-284
Classification Level Classification E-value
Superfamily SAP domain 0.0000153
Family SAP domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028278   Gene: ENSGGOG00000009889   Transcript: ENSGGOT00000024060
Sequence length 357
Comment pep:known_by_projection chromosome:gorGor3.1:12:121275875:121300160:1 gene:ENSGGOG00000009889 transcript:ENSGGOT00000024060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVC
KACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKD
LRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSN
YTAPSATMSSFQGELMDGEQTSRSGVPAQVQSEITSANTEEENAEDRNPGLSKERVRASL
SDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQ
LQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS
Download sequence
Identical sequences ENSGGOP00000028278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]