SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028322 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028322
Domain Number 1 Region: 78-164
Classification Level Classification E-value
Superfamily HMG-box 2.23e-32
Family HMG-box 0.00000625
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 6.81e-27
Family HMG-box 0.00000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028322   Gene: ENSGGOG00000026764   Transcript: ENSGGOT00000027542
Sequence length 186
Comment pep:novel chromosome:gorGor3.1:13:12304627:12307920:-1 gene:ENSGGOG00000026764 transcript:ENSGGOT00000027542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
MKKKKK
Download sequence
Identical sequences ENSGGOP00000028322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]