SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028323 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028323
Domain Number 1 Region: 1287-1529
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-55
Family Ankyrin repeat 0.000000066
Further Details:      
 
Domain Number 2 Region: 151-284
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000282
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 709-848
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000643
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 283-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000989
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 526-649
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000816
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 6 Region: 9-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000309
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 497-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 8 Region: 680-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 47-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 10 Region: 1040-1070
Classification Level Classification E-value
Superfamily Notch domain 0.0000000484
Family Notch domain 0.0035
Further Details:      
 
Domain Number 11 Region: 84-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000139
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 12 Region: 390-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000155
Family EGF-type module 0.007
Further Details:      
 
Domain Number 13 Region: 1005-1037
Classification Level Classification E-value
Superfamily Notch domain 0.00000119
Family Notch domain 0.0049
Further Details:      
 
Domain Number 14 Region: 430-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000157
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 652-688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000375
Family EGF-type module 0.03
Further Details:      
 
Domain Number 16 Region: 126-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000252
Family EGF-type module 0.023
Further Details:      
 
Domain Number 17 Region: 846-886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000676
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028323
Domain Number - Region: 969-996
Classification Level Classification E-value
Superfamily Notch domain 0.000183
Family Notch domain 0.0022
Further Details:      
 
Domain Number - Region: 463-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family EGF-type module 0.0097
Further Details:      
 
Domain Number - Region: 925-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0947
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028323   Gene: ENSGGOG00000002258   Transcript: ENSGGOT00000024824
Sequence length 1765
Comment pep:known_by_projection chromosome:gorGor3.1:19:15446415:15480040:-1 gene:ENSGGOG00000002258 transcript:ENSGGOT00000024824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHN
GGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGL
LCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGR
CVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCE
VDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPD
GYECRCAEGFEGTLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECR
SQPCRHGGKCLDLVDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQP
GFTGPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGLAPTCLPPSHPCAHEPCSHGI
CGSFSCTCHGGYTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVD
ECLSNPCGGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLC
RPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQVRLEQLCQAGGQ
CVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCE
DDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPWTQGPCLHNGTC
VDLVGGFRCTCPPGYTGLRCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPR
CQTVLSPCESQPCQHGGVPSPGSWGFTCHCAQDPQGSACERVARSCRELQCPVGVPCQQT
PRGPRCACPLCRDPFPGRRASNASRGRPCLHGGSCRPAARPFFRCACAGLDRRCEARRGT
LSEEPRCPRAACQANADQRCDRECNSPGCGWDGGDCPVSGGDPWRQCEALQCWRLFNNSR
CDPACSSPACLYDNFDCHPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLAR
GVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHSVVMLEIDNRL
CLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVREPLEPPEPSVPLLPLLVAGA
VLLLVILVLGVMVARRKREHSTLWFPEGFSLHKDVASGHKGRREPVGQDALGMDCRQWTQ
HHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCGGALEPANEDEAD
DTSASIISDLICQGASLGHTDRTGETALHLAARYARADAAKRLLDAGADTNAQDHSGRTP
LHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVEELIASHADVNAV
DELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHF
ANREITDHLDRLPRDVAQERLHQDIVRLLDNPVGPQPPRSPRLGPLLCPPGAFLPGLKAD
SRGKKSRRPPGKRGWGRRPRGRGKKLTLACPGPLADSSVTLSPVDSLDSGLSVGPLLPLV
ASPLRGPMQLPAVWHSLVAQAGRVAPDVYGLLNPVAVPRFPHLPLQAPRSCAIRDPSCSR
DPRLPTGAAPALWQSQDMARSTRQLGHTAPPKARFLRVPSEHPYLTPSPESPEHWASPSP
PSLSDWSESTPSPATATGAMATSTG
Download sequence
Identical sequences ENSGGOP00000028323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]