SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028346 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028346
Domain Number 1 Region: 4-33
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000057
Family Erythroid transcription factor GATA-1 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028346   Gene: ENSGGOG00000023375   Transcript: ENSGGOT00000031935
Sequence length 269
Comment pep:known_by_projection chromosome:gorGor3.1:7:89708852:89718240:1 gene:ENSGGOG00000023375 transcript:ENSGGOT00000031935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGF
GAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHI
FKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCE
KSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTV
PTRPEKGYIWTHVGPTPAITIKETVANHL
Download sequence
Identical sequences A0A2J8WJY6 G3SJQ6
ENSGGOP00000021410 ENSGGOP00000028346 XP_004045784.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]