SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028354 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028354
Domain Number 1 Region: 237-369
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.3e-27
Family FHA domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028354   Gene: ENSGGOG00000022697   Transcript: ENSGGOT00000034275
Sequence length 396
Comment pep:known_by_projection chromosome:gorGor3.1:1:38793230:38810903:-1 gene:ENSGGOG00000022697 transcript:ENSGGOT00000034275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEP
ARPGHRGNRARGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGRE
DRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEERE
FYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFR
GVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCS
KQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKF
GFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS
Download sequence
Identical sequences G3SJR4 H2PYP1
XP_003815539.1.60992 XP_004025530.1.27298 XP_513324.2.37143 ENSGGOP00000028354 ENSPTRP00000000966 ENSPTRP00000000966 9598.ENSPTRP00000000966 ENSGGOP00000028354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]