SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028384 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028384
Domain Number 1 Region: 390-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.06e-48
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000111
Further Details:      
 
Domain Number 2 Region: 570-671
Classification Level Classification E-value
Superfamily E set domains 1.53e-27
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028384   Gene: ENSGGOG00000010145   Transcript: ENSGGOT00000022775
Sequence length 1007
Comment pep:known_by_projection chromosome:gorGor3.1:16:58367423:58444115:1 gene:ENSGGOG00000010145 transcript:ENSGGOT00000022775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIDLEPDDCASIYIFNVDPPPSTLNTPLCLPHHGLPSHSSVLSPSFQLQSHKNYEGTCEI
PESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHLYLP
LEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLTSP
GGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPTSPCG
KRRHSSAEVCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNASVHGGSGLGPAIFPFQYCV
ETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQF
LSVPSPFTWSKPKPGHTPIFRTSSLPPLDWPLPAHFGQCELKIEVQPKTHHRAHYETEGS
RGAVKASTGGHPVVKKDLLNYNDLPVILQRTISKENWRYLTQKRFYSTGRITNKKTKAQT
LLNVTILFSTVVEYNIVPDNGLNFSIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFR
VHIPQPSGKVLSLQIASIPVECSQRSAQELPHIEKYSINSCSVNGGHEMIVTGSNFLPES
KIIFLEKGQVDGRPQWEVEGKIIREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRK
KSQSQRFTYTPVLMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSRQRSLV
CSIPQTYASMVTSSHLPQLQCRDESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTN
VVYNGPTCLPINAASSQEFDSVLFQQDATLSGLVNLGCQPLSSIPFHSSNSGSTGHLLAH
TPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQPSSQLQPITYGPSHSGSATTASP
AASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQSTGQGGLSA
PSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDD
Download sequence
Identical sequences ENSGGOP00000028384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]