SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028391 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028391
Domain Number 1 Region: 35-96
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000733
Family HLH, helix-loop-helix DNA-binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028391   Gene: ENSGGOG00000027653   Transcript: ENSGGOT00000031277
Sequence length 143
Comment pep:known_by_projection chromosome:gorGor3.1:8:65241925:65242356:-1 gene:ENSGGOG00000027653 transcript:ENSGGOT00000031277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAEPAPLAAAIRDSSPGRTGPGPAGPGGGSRSGSGRPAAANAARERSRVQTLRHAFLELQ
RTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDAEAPADAGLGALRGDGYLHPVKVSG
RGAPRGWGRDQDTLICPASHRLG
Download sequence
Identical sequences ENSGGOP00000028391 9598.ENSPTRP00000034771 ENSGGOP00000028391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]