SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028440 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028440
Domain Number 1 Region: 76-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028440   Gene: ENSGGOG00000026908   Transcript: ENSGGOT00000027194
Sequence length 318
Comment pep:known_by_projection chromosome:gorGor3.1:7:31742372:31743385:-1 gene:ENSGGOG00000026908 transcript:ENSGGOT00000027194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAHGLPRRRGL
RKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLA
KNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHH
TRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGP
LSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLH
LRSQSLTMQDELNAVFHN
Download sequence
Identical sequences G3TK07
ENSLAFP00000015117 ENSLAFP00000015117 ENSGGOP00000028440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]