SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028457 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000028457
Domain Number - Region: 151-221
Classification Level Classification E-value
Superfamily HIT-like 0.00709
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028457   Gene: ENSGGOG00000004806   Transcript: ENSGGOT00000004828
Sequence length 385
Comment pep:known_by_projection chromosome:gorGor3.1:15:70062916:70064108:1 gene:ENSGGOG00000004806 transcript:ENSGGOT00000004828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPHDSNETSYLLPPNNEDWDGQTIPDFVYGQKDLTAEGIQWPRNAPGIPDALPQSPFD
AALCSAWKQRVELGLFRYRLRELQTQILPGAVGFVAQLNVERGVQRRPPQTIKSVRQAFD
PVQFNFNKIRPGEVLFRLHREPDLPGTLLQEDILVVINVSPLEWGHVLLVPEPARQLPQR
LLPGALRAGIEAVLLSLHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEQAPSEPLDP
GGHLHLLQDLPAPGFLFYTRGPGPDLESLINRVCQATDYLTDHEIAHNLFVTRGAPPGKT
SPSSTLTGVRVILWARKSSFGIKDGEAFNVALCELAGHLPVKTSQDFSSLTEAAAVALIQ
DCRLPPSQAEEVQAALVALMSQEEQ
Download sequence
Identical sequences G3SK14
ENSGGOP00000028457 ENSGGOP00000028457 XP_004056807.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]