SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028469 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000028469
Domain Number - Region: 345-369
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0133
Family CCCH zinc finger 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028469   Gene: ENSGGOG00000024638   Transcript: ENSGGOT00000029199
Sequence length 825
Comment pep:known_by_projection chromosome:gorGor3.1:X:62692720:62711716:1 gene:ENSGGOG00000024638 transcript:ENSGGOT00000029199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSASKEEKQQPKQDSTEQGNADSEEWMSSESDPEQISLKSSDNSKSCQPRDGQLKKKE
MHSKPHRQLCRSPCLDRPSFSQSSILQDGKLDLEKEYQAKMEFALKLGYAEEQIQSVLNK
LGPESLINDVLAELVRLGNKGDSEGQINLSLLVPRGPSSREIASPELSLEDETDNSDNLR
PVVIDGSNVAMSHGNKEEFSCRGIQLAVDWFLDKGHKDITVFVPAWRKEQSRPDAPITDQ
DILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFDSDGIIVSNDNYRDLQVEKPEW
KKFIEERLLMYSFVNDKFMPPDDPLGRHGPSLENFLRKRPIVPEHKKQPCPYGKKCTYGH
KCKYYHPERANQPQRSVADELRISAKLSTVKTMSEGTLAKCGTGMSSAKGEITSEVKRVA
PKRQSDPSIRSVAVEPEEWLSIARKPEASSVPSLVTALSVPTIPPPKSHAVGALNTRSAS
SPVPGSSHFPHQKASLEHMASMQYPPILVTNSHGTPISYAEQYPKFESMGDHGYYSMLGD
FSKLNINSMHNREYYTAEVDRGVYARNPNLCSDSRVSHTRNDNYSSYNNVYLAVADTHPE
GNLKLHRSASQNRLQPFPHGYHEALTRVQSYGPEDSKQGPHKQSVPHLALHAQHPSTGTR
SSCPADYPMPPNIHPGATPQPGRALVMTRMDSISDSRLYESNPVRQRRPPLCREQHASWD
PLPCATDSYGYHSYPLSNSLMQPCYEPVMVRSVPEKMEQLWRNPWVGMCNDSREHMIPEH
QYQTYKNLCNIFPSNIVLAVMEKNPHTADAQQLAALIVAKLRAAR
Download sequence
Identical sequences ENSGGOP00000028469 ENSGGOP00000028469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]