SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028497 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028497
Domain Number 1 Region: 248-307
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000543
Family SNARE fusion complex 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028497   Gene: ENSGGOG00000011121   Transcript: ENSGGOT00000031302
Sequence length 336
Comment pep:known_by_projection chromosome:gorGor3.1:4:4713796:4836297:-1 gene:ENSGGOG00000011121 transcript:ENSGGOT00000031302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVDITLLFRASVKTVKTQNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHI
GKLRDFLLEHRKDYINAYRNSMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHK
EIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES
TSSEKVSQSPSKDSEENPATEERPAEKILAETQPELGTWGDGKGEDELSPEEIQMFEQEN
QRLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGN
EDIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS
Download sequence
Identical sequences ENSGGOP00000010843 ENSGGOP00000028497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]