SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028503 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028503
Domain Number 1 Region: 464-677
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-32
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 2 Region: 689-890
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-27
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 912-1113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-26
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 4 Region: 148-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000357
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 5 Region: 224-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000729
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 6 Region: 1298-1338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000105
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 7 Region: 1141-1182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000929
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 8 Region: 186-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000109
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 9 Region: 304-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000156
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 262-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000042
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 11 Region: 1212-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000177
Family EGF-type module 0.03
Further Details:      
 
Domain Number 12 Region: 72-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 1177-1217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000778
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 111-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000299
Family EGF-type module 0.018
Further Details:      
 
Domain Number 15 Region: 398-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000051
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 16 Region: 1265-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000174
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028503
Domain Number - Region: 340-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000228
Family EGF-type module 0.0072
Further Details:      
 
Domain Number - Region: 925-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00348
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0129
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 886-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0303
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028503   Gene: ENSGGOG00000028567   Transcript: ENSGGOT00000023145
Sequence length 1407
Comment pep:known_by_projection chromosome:gorGor3.1:1:177115429:177282945:1 gene:ENSGGOG00000028567 transcript:ENSGGOT00000023145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQRKIFNFVLIYKFNLVTFYFLVDSFCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTA
NNLDKDCDNMKDPCISNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQ
HGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVDECASDPCKNEATCLNEIGRYTCICPHNYSGVNCELEIDECWSQPCLNGATCQ
DALGAYFCDCAPGFLGDHCELNTDECASQPCLHGGLCVDGENRYSCNCTGSGFTGTHCET
LMPLCWSKPCHNNATCEDSVDNYTCHCWPGYTGAQCEIDINECNSNPCQSNGECVELSSE
KQYGRITGLPSAFSYHEASGYVCICQPGFTAGIHCEEDVNECSSNPCQNGGTCENLPGNY
TCHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGTCIPDFQDGQHGFSCLCPSGYTGSL
CEITTTLSFEGDGFLWVKSGSVTTKDSVCNVALRFQTVQPMALLLFRSNRDVFVKLELLS
GYIHLSIQVNNQSKVLLFISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKCIAKAPSPL
ESDQSICAFQNSFLGGLPVGMTSSGVALPNFYNIPSTPSFVGCLQDIKIDWNHITLENIS
SGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYKGPNCLREYVAGRFGQD
DSTGYVIFTLDESYGDTISLSMFVRTLQPSGLLLALENSTYQYIRVWLERGRLAMLTPNS
PKLVVKFVLNDGNVHLISLKIKPNKIELYQSSQNLGFISASTWKIKKGDVIYIGGLPDKQ
ETELNGGFFKGCIQDVRLNNQTLEFFPNPANNASLNPVLVNVTQGCPGDNSCKSNPCHNG
GVCRSRWDDFSCSCPAHTSGKACEEVQWCGFSPCPRGAQCQPVLQGFECIANAVFNGQSS
QILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQSGNSFY
MLSLTSLQSVNDGTWHEVTLSMTDPLSQTSRWQMEVDNETPFVTSTIATGSLNFLKDNTD
IYVGDRAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFINKPQEEQFLKISTNSVVTGCLQ
LNVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNIDECFSNPCIHGNCSDRVAAYH
CTCEPGYTGVNCEVDIDNCQSHQCANGATCISHTNGYSCLCFGNFTGKFCRQSRLPSTVC
GNEKTNLTCYNGGNCTEFQAELKCMCRPGFTGEWCEKDIDECASDPCVNGGLCQDLLNKF
QCLCDVAFAGERCEVDLADDLISDIFTTIGSVTLALLLILLLAIVASVVTSNKRAAQGTY
SPSRQEKEGSRVEMWNLMPPPAMERLI
Download sequence
Identical sequences ENSGGOP00000028503 ENSGGOP00000028503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]