SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028507 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028507
Domain Number 1 Region: 124-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000018
Family LIM domain 0.023
Further Details:      
 
Domain Number 2 Region: 93-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000428
Family LIM domain 0.028
Further Details:      
 
Domain Number 3 Region: 237-300
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000018
Family Homeodomain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028507   Gene: ENSGGOG00000008310   Transcript: ENSGGOT00000031493
Sequence length 348
Comment pep:known_by_projection chromosome:gorGor3.1:9:105517282:105532476:-1 gene:ENSGGOG00000008310 transcript:ENSGGOT00000031493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWKHENAAPALPEGCRLPAEGGPATDQVSRRTTGCARISAPLSFSPPPQAQSDAEALAG
ALDKDEGQASPCTPSTPSVCSPPSAASSVPSAGKNICSSCGLEILDRYLLKVNNLIWHVR
CLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNAYH
LACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPSEQD
SQPKPAKRARTSFTAEQLQVPLQAVGGGGGRRVRLFSSRLRLLRLSFQVWFQNCRARHKK
HTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESK
Download sequence
Identical sequences ENSGGOP00000028507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]