SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028510 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028510
Domain Number 1 Region: 187-223
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000196
Family CCCH zinc finger 0.00017
Further Details:      
 
Domain Number 2 Region: 150-185
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000392
Family CCCH zinc finger 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028510   Gene: ENSGGOG00000001402   Transcript: ENSGGOT00000032251
Sequence length 427
Comment pep:known_by_projection chromosome:gorGor3.1:2a:43799992:43875348:-1 gene:ENSGGOG00000001402 transcript:ENSGGOT00000032251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASN
LHALAHPAPSPGSCSPKFPGAANGSSCGSAVAGGPTSYGTLKEPSGGGGTALLNKENKFR
DRSFSENGDRSQHLLHLQQQQKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGF
HELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGTRD
ALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCS
SSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPCAACSSASCAN
NAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQGLAPPAQPPAPPSATLPAXX
XAPPSPP
Download sequence
Identical sequences ENSGGOP00000028510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]