SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028519 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028519
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2e-23
Family THAP domain 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028519
Domain Number - Region: 136-182
Classification Level Classification E-value
Superfamily Prefoldin 0.00167
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028519   Gene: ENSGGOG00000022708   Transcript: ENSGGOT00000027101
Sequence length 213
Comment pep:known_by_projection chromosome:gorGor3.1:8:42959553:42966485:-1 gene:ENSGGOG00000022708 transcript:ENSGGOT00000027101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTP
DCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLM
PPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKL
KEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Download sequence
Identical sequences A0A0D9RR28 A0A2J8TNT4 G3SK76 H2QW39 Q5RCE4 Q9NVV9
gi|8922446|ref|NP_060575.1| ENSPTRP00000034614 ENSPTRP00000034614 NP_001125299.1.23681 NP_060575.1.87134 NP_060575.1.92137 XP_003823323.1.60992 XP_004047016.1.27298 XP_007960538.1.81039 XP_528123.1.37143 ENSP00000254250 ENSGGOP00000028519 ENSGGOP00000028519 GO.42353 hss001001240.1 9598.ENSPTRP00000034614 9606.ENSP00000254250 ENSP00000254250 ENSP00000254250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]