SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028524 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028524
Domain Number 1 Region: 24-116
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 3.41e-17
Family Interleukin 8-like chemokines 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028524   Gene: ENSGGOG00000012830   Transcript: ENSGGOT00000034361
Sequence length 127
Comment pep:known_by_projection chromosome:gorGor3.1:17:50231061:50239136:1 gene:ENSGGOG00000012830 transcript:ENSGGOT00000034361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITQIPKHTDFLVILNCYHASETILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL
AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET
YGHKTPY
Download sequence
Identical sequences ENSGGOP00000028524 ENSGGOP00000028524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]