SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028537 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028537
Domain Number 1 Region: 25-221
Classification Level Classification E-value
Superfamily Caspase-like 1.79e-54
Family Caspase catalytic domain 0.0000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028537   Gene: ENSGGOG00000026344   Transcript: ENSGGOT00000022778
Sequence length 224
Comment pep:known_by_projection chromosome:gorGor3.1:4:119082935:119097404:-1 gene:ENSGGOG00000026344 transcript:ENSGGOT00000022778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCAD
RDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEACRGNQHDVPVIPLDVVDSQTDKLDTNI
TEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELL
TLVNRKVSHRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Download sequence
Identical sequences ENSGGOP00000028537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]