SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028546 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028546
Domain Number 1 Region: 191-419
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.49e-94
Family SMAD domain 0.00000000458
Further Details:      
 
Domain Number 2 Region: 17-135
Classification Level Classification E-value
Superfamily SMAD MH1 domain 3.53e-46
Family SMAD MH1 domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028546   Gene: ENSGGOG00000023966   Transcript: ENSGGOT00000031646
Sequence length 428
Comment pep:known_by_projection chromosome:gorGor3.1:5:119607277:119661724:1 gene:ENSGGOG00000023966 transcript:ENSGGOT00000031646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCQMTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALS
SPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSK
QKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSF
HQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPDVQPVAYEEPKHWCSIVYY
ELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLY
YVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVN
HGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSP
LNPISSVS
Download sequence
Identical sequences ENSGGOP00000028546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]