SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028547 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028547
Domain Number 1 Region: 113-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 2 Region: 203-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000409
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 160-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 4 Region: 64-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000204
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028547
Domain Number - Region: 516-755
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00421
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028547   Gene: ENSGGOG00000005405   Transcript: ENSGGOT00000028389
Sequence length 798
Comment pep:known_by_projection chromosome:gorGor3.1:19:14659577:14679772:1 gene:ENSGGOG00000005405 transcript:ENSGGOT00000028389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLIFWPAFCVWLTLPGAETQDSTGCAQWCPQNSSCVNATACRCNPGFSSFSEIITTPTE
TCDDINECATPSKVSCGKFSDCWNTEGSYDCMCSPGYEPVSGAKTFKNENENTCQDVDEC
QQNPRLCKSHGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNN
VGSYQCCCRPGWQPIPGSPNGPNNTICEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPG
WKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQN
VIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDTMRVLAKSLPKGPFTYVSPSNTEL
TLMIQERGDKNVTMGQSNARMKLNWAVAAGAEDPGSSGGLEGEPVGERWRCWDGARVRFR
IWNNAALLDSAQAQDLRVSSRPTFLTTLICPQDVMPGPRQELLCAFWKSDSDRGGHWATE
GCQVLGSKNGSTTCQCSHLSSFAILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLL
VRPIQGSRTTIHLHLCICLFVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMS
LEGLELYFLVVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQG
FLWSFLGPVTFIILCNAVIFVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGC
TWVFGLFIFDDRSLVLTYVFTILNCLQGAFLYLLHCLLNKKVEDSQGEWAGVGRKAPGLA
GLRPLGSPLQALRASESG
Download sequence
Identical sequences ENSGGOP00000028547 ENSGGOP00000028547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]