SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028562 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028562
Domain Number 1 Region: 261-459
Classification Level Classification E-value
Superfamily Thiolase-like 1.06e-65
Family Thiolase-related 0.00000618
Further Details:      
 
Domain Number 2 Region: 44-297
Classification Level Classification E-value
Superfamily Thiolase-like 1.98e-65
Family Thiolase-related 0.000000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028562   Gene: ENSGGOG00000024796   Transcript: ENSGGOT00000033039
Sequence length 461
Comment pep:known_by_projection chromosome:gorGor3.1:3:26585180:26592358:1 gene:ENSGGOG00000024796 transcript:ENSGGOT00000033039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMSNCLQNFLKITSTRLLCSRLCQQLTRNKRKFFGTVPISRLHRRVVITGIGLVTPLGVG
THLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSP
TIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPF
FVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDS
CISPLSLAGFSRARALSTNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARI
YAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYINAHATSTPLGDAA
ENKAIKHLFKDHAYALAVSSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEP
EFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL
Download sequence
Identical sequences ENSGGOP00000028562 ENSGGOP00000028562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]