SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028591 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028591
Domain Number 1 Region: 105-349
Classification Level Classification E-value
Superfamily PA domain 1.57e-77
Family PA domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 51-98,331-542
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.49e-68
Family FolH catalytic domain-like 0.000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028591   Gene: ENSGGOG00000034824   Transcript: ENSGGOT00000041053
Sequence length 546
Comment pep:known_by_projection chromosome:gorGor3.1:11:87409982:87589385:1 gene:ENSGGOG00000034824 transcript:ENSGGOT00000041053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESRGRLYLWMCLAAALASFLMGFMVGWFIKPLKETATSVRYHQSIRWKLVSEMKAENI
KSFLRSFTKLPHLAGTEQNFLLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISI
VDEHETEIFKTSYLEPPPDGYENVTNIVPPYNAFSAQGMPEGDLVYVNYARTEDFFKLER
EMGINCTGKIVIARYGKIFRGNKVKNAMLAGAIGIILYSDPADYFAPEVQPYPKGWNLPG
TAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLRYLG
GIAPPDNSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNINKITRIYNVVGTIRGSVEPDR
YVILGGHRDSWVFGAIDPTSGVAVLQEIARSFGKLMSKGWRPRRTIIFASWDAEEFGLLG
STEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEIPSPDDGFES
KSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKHTDDKSSYP
IYYVVH
Download sequence
Identical sequences ENSGGOP00000028591 ENSGGOP00000028591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]