SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028622 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028622
Domain Number 1 Region: 511-819
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000997
Further Details:      
 
Domain Number 2 Region: 782-1079
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.99e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000182
Further Details:      
 
Domain Number 3 Region: 6-201
Classification Level Classification E-value
Superfamily Fibronectin type III 6.56e-28
Family Fibronectin type III 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028622   Gene: ENSGGOG00000034859   Transcript: ENSGGOT00000041093
Sequence length 1080
Comment pep:known_by_projection chromosome:gorGor3.1:20:39746951:40148207:-1 gene:ENSGGOG00000034859 transcript:ENSGGOT00000041093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADPVHGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSYNLTVQYQYVFNQQQYEAEEVIQT
SSHYTLRGLRPFMTIRLRLLLSNPEGRMESEELVVQTEEDVPGAVPLESIQGGPFEEKIY
IQWKPPNETNGVITLYEINYKAVGSLDPTADLSSQRGKVFKLRNETHHLFVGLYPGTTYS
FTIKASTAKGFGPPVTTRIATKISAPSMPEYDTDTPLNETDTTITVMLKPAQSRGAPVSV
YQLVVKEERLQKSRRAADIIECFSVPVSYRNASSLDSLHYFAAELKPANLPVTQPFTVGD
NKTYNGYWNPPLSPLKSYSIYFQALSKANGETKINCVRLATKAPMGSAQVTPGTPLCLLT
TGASTQNSNTVEPEKQVDNTVKMAGVIAGLLMFIIILLGVMLTIKRRRNAYSYSYYLSQR
KLAKKQKETQSGAQREMGPVASADKPTTKLSASRNDEGFSSSSQDVNGFTDGSRGELSQP
TLTIQTHPYRTCDPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQT
ASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQ
GPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPL
AEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIV
VHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAIL
EACLCGNTAIPVCEFRSLYYNISRLDPQTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLPR
NHDKNRSMDVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFVVTQHPLPNTVADFW
RLVFDYNCSSVVMLNEMDTAQFCMQYWPEKTSGCYGPIQVEFVSADIDEDIIHRIFRICN
MARPQDGYRIVQHLQYIGWPAYRDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLNG
GGRSGTFCAICSVCEMIQQQNIIDVFHIVKTLRNNKSNMVETLEQYKFVYEVALEYLSSF
Download sequence
Identical sequences ENSGGOP00000028622 ENSGGOP00000028622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]