SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028654 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028654
Domain Number 1 Region: 947-1229
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 7.32e-57
Family Patatin 0.065
Further Details:      
 
Domain Number 2 Region: 609-725
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-21
Family cAMP-binding domain 0.0065
Further Details:      
 
Domain Number 3 Region: 164-302
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-20
Family cAMP-binding domain 0.023
Further Details:      
 
Domain Number 4 Region: 484-614
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-18
Family cAMP-binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028654   Gene: ENSGGOG00000034988   Transcript: ENSGGOT00000041155
Sequence length 1342
Comment pep:known_by_projection chromosome:gorGor3.1:9:121093421:121194750:-1 gene:ENSGGOG00000034988 transcript:ENSGGOT00000041155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEKDDGPQADFCLGTALHSWGLWFTEEGSPSTMLTGIAVGALLALALVGVLILFMFRR
LSQFRQAQPTPQYRFRKRDKVMFYGRKIMRKVTTLPNTLVENTALPRQRARKRTKVLSLA
KRILRFKKEYPALQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHIVFVQLQEGEHVFQPREPDPSICVVQDGRLEVCIQDTDGTEVVVKEVLAGDSVHS
LLSILDIITGHAAPYKTVSVRAAIPSTILRLPAAAFHGVFEKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAIPLVSVASVAAGKAKKQVFYGEEERLKKPPRLQESCD
SDHGGGRPVAAGPLLKRSHSVPAPSIRKEILDELEKPGAGDPDPSAPQGGAGSATSDLGM
ACDRARVFLHSDEHPGSSVASKSRKSMMVAEIPSTVSHHSESHTDETLASRKSDAIFRAA
KKDLLTLMKLEDSSLLDGRVALLHVPAGMVVSRQGDQDASILFVISGLLHVYQRKIGSQE
DSCLFLTRPGEMVGQLAVLTGEPLIFTIKANRDCSFLSISKAHFYEIMRKQPTVVLGVAH
TVVKRMSSFVRQIDFALDWVEVEAGRAIYRQGDKSDCTYIMLSGRLRSVIRKDDGKKRLA
GEYGRGDLVGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGE
KILGSLQQGPVTGHQLGLPTEGSKWDSGNPAVNLSTVAVMPVSEEVPLTAFALELEHALS
AIGPTLLLTSDNIKRRLGSAALDSVHEYRLSSWLGQQEDTHRIVLYQADGTLTPWTQRCV
RQADCILIVGLGDQEPTVGELERMLESTAVRAQKQLILLHREEGPAPARTVEWLNMRSWC
SGHLHLCCPRRVFSRRSLPQLVEMYKRVFQRPPDRHSDFSRLARVLTGNAIALVLGGGGA
RGCAQVGILKALAECGIPVDMVGGTSIGAFMGALYSEERNYSQMRIRAKHWAEGMTSMMK
AALDLTYPITSMFSGAGFNSSIFSVFKDRQIEDLWIPYFAITTDITASAMRVHTDGSLWR
YVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLT
NYGDALSGWWLLWKRWNPLATKVKVLNMAEIQARLAYVCCVRQLEVVKSSDYCEYLRPPI
DSYGTLDFGKFNEICEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPTSAVLTCPNAS
FTDLAEIVSRIEPAKPAMVDDESDYQTEYEEELLDVPRDAYADFQSTSAQRGSDSEDESS
LRHRHPGLAFPKLSEGSSDQDG
Download sequence
Identical sequences ENSGGOP00000028654 ENSGGOP00000028654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]