SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028673 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028673
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.84e-20
Family FHA domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028673
Domain Number - Region: 599-789
Classification Level Classification E-value
Superfamily Tropomyosin 0.0137
Family Tropomyosin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028673   Gene: ENSGGOG00000034879   Transcript: ENSGGOT00000041167
Sequence length 828
Comment pep:known_by_projection chromosome:gorGor3.1:3:59219646:59387101:1 gene:ENSGGOG00000034879 transcript:ENSGGOT00000041167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSALAIFTCRPNSHPFQERHVYLDEPIKIGRSVARCRPAQNNATFDCKVLSRNHALVWF
DHKTGKFYLQDTKSSNGTFINSQRLSRGSEESPPCEILSGDIIQFGVDVTENTRKVTHGC
IVSTIKLFLPDGMEARLRSDVIHAPLPSPVDKVAANTPSMYSQELFQLSQYLQEALHREQ
MLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKEL
IALQEDKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEEL
RELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKGQAEKKELQHKIDEMEEKEQELQAKI
EALQADNDFTNERLTALQVRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQKKLI
VEGHLTKAVEETKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVS
LLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEE
STKQIQVLQAQLQRLHIDIENLREEKDSEITSTRDELLSARDEILLLHQAAEKVASERDT
DIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELE
KLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELEN
QVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITD
ELKQCKNNLKLLREKGNNKPWPWMPMLAALVAVTAIVLYVPGLARASP
Download sequence
Identical sequences A0A2I3S7F4 G3SKN0
ENSGGOP00000028673 XP_001173863.1.37143 XP_003811680.1.60992 XP_018879915.1.27298 ENSGGOP00000028673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]