SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028683 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028683
Domain Number 1 Region: 13-213
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.53e-24
Family Protein-L-isoaspartyl O-methyltransferase 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028683
Domain Number - Region: 341-359
Classification Level Classification E-value
Superfamily SOCS box-like 0.0876
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028683   Gene: ENSGGOG00000034899   Transcript: ENSGGOT00000041056
Sequence length 361
Comment pep:known_by_projection chromosome:gorGor3.1:20:62484833:62552792:1 gene:ENSGGOG00000034899 transcript:ENSGGOT00000041056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGN
IHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEY
AKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNL
LKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLIQPCHSESGKSRLVQLPPVAV
RSLQDLARIAIRGTIKKIIHQETVSRNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFAS
RISNPSDDNSGEDLEEERREEEEKTPPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYRE
K
Download sequence
Identical sequences A0A2I2YGK4
ENSGGOP00000028683 ENSGGOP00000028683 XP_004062627.1.27298 XP_018872777.1.27298 XP_018872778.1.27298 XP_018872779.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]