SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028693 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028693
Domain Number 1 Region: 96-272
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-24
Family DBL homology domain (DH-domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028693   Gene: ENSGGOG00000034889   Transcript: ENSGGOT00000041151
Sequence length 705
Comment pep:known_by_projection chromosome:gorGor3.1:2a:39595600:39634002:1 gene:ENSGGOG00000034889 transcript:ENSGGOT00000041151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSAAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLKSCLSADIQSKGHLPSGMWRQPKD
GKEWGEEYVTKDHPDKLKEAGQGRHSSLENVLCETSLAAKRQTVALELLESERKYVINIS
LILKIKATFQGSDGKRNSKERSLFPGSLRYLVQQHLDLLHALQERVLKWPRQGVLGDLFL
KLTNDENNFLDYYVAYLRDLPECISLVHVVVLKEGDEEIKSDIYTLFFHIVQRIPEYLIH
LQNVLKFTEQEHPDYYLLLVCVQRLRVFISHYTLLFQCNEDLLIQKRKKLKKSSMAKLYK
GLASQCANAGQDASPTAGPEAVRDTRIHSEELLQPYPSAPSSGPAVTHLMPPVKKSQQQQ
SLMESMQPGKPSDWELEGRKHERPESLLAPTQFCAAEQDVKALAGPLQAIPEMDFEPSPA
EPLGNVERSLRAPAELLPDARGFVPAAYEEFEYGGEIFALPAPYDEEPFQAPALFENCSP
ASSESSLDICFLRPVSFAMEAERPEHPLQPLPKSATSPAGSSSAYKLEAAAQAHGKAKPL
SRSLKEFPRAPPADGVAPRLYSTRSSSGGRAPIKAERAAQPHGPAAAAVAARGAPRTFFP
QQRSQSEKQTYLEVRREMHLEDTTRFCPKEERESEQTSFSDQNPRQDQKGGFRSSFRKLF
KKKSSGSEYREKTNENPSMDPSPTKQDFFRNRLALANDLDQGTAV
Download sequence
Identical sequences ENSGGOP00000028693 ENSGGOP00000028693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]