SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028698 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028698
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000000272
Family HSP20 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028698   Gene: ENSGGOG00000034818   Transcript: ENSGGOT00000041085
Sequence length 577
Comment pep:known_by_projection chromosome:gorGor3.1:3:74494828:74595748:-1 gene:ENSGGOG00000034818 transcript:ENSGGOT00000041085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGS
EQGSYDADKGIFTIRLPKETPGQHFEGLNMLTALLAPRKSRTAKPLVEEIVASEIPEEVV
DDEEFDWEIEQTPYEEVSESALNPQCHYGFGNLRSGVLQRLQDELSDVVDIKDPDFTPAA
ERRQKRLATELAKFDPDHYLADFFEDEAIEQILKYNPWWTDKYSKMTAFLEKSQEQENHA
TLVSFSEEEKYQLRKFVNKSYLLDKRACRQVCYSLIDILLAYCYETRVTEGEKNVESAWN
IRKLSPTLCWFETWTNVHDIVVSFGRRVLCYPLYRHFKLVMKAYRDTIKILQLGKSAVLK
CLLDIHKIFQENDPAYILNDLYISDYCVWIQKVKSKKLAALAEALKEVSLTKAQLGLELE
ELEAAALLVQEEETALKAAHSVSGQQTLCSSSEASDSEDSDSTVSSGNEDSGSDSEQDEL
KDSPSETVNSLQGPFLEESSALLIVDGGVRRNTAIQESDASQGKPLSSSWPLGVSGPLIE
ELGEQLKTTVQVSEPKGTTAVNRSNMQERDGCQTPNN
Download sequence
Identical sequences ENSGGOP00000028698 ENSGGOP00000028698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]