SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028711 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028711
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.43e-23
Family FHA domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028711   Gene: ENSGGOG00000034832   Transcript: ENSGGOT00000041133
Sequence length 511
Comment pep:known_by_projection chromosome:gorGor3.1:2a:69751051:69858762:1 gene:ENSGGOG00000034832 transcript:ENSGGOT00000041133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGFELQPRDGGRRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQLRIKPIHTN
PCFYQSSEKSQLLPLKPNLWCYLNPGDSFSLLVDKYIFRVLSIPSEVEMQCTLRNSQVLD
EDNILNETPKSPVINLPHETTGASQLEGSTEIAKTQMTPTNSVSFLGENRDCSKQQPILA
ERKRILPAWMLAEHLSDQNLSVPAISGGNVIQGSGKEEICKDKTQLNTTQQGRRQLISSG
SSENTSAEQDTGEKCKNTDQKESTISSKEMPQSYSAITLSNTEMNNIKTNAQRNKLPIEE
LGKVSKHKIATKRTPHKEDEAMSCSENCSSAQGESFQDESQGSHSESSSNPSNPETLHAK
ATDSVLQGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGSVQIVGQDETDDRPE
CPYGPSCYRKNPQHKIEYRHNTLAVRNVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTD
EDSDWEPGKEDEEKEDVEELLKEAKRFTKRK
Download sequence
Identical sequences G3SKR8
XP_004029419.2.27298 ENSGGOP00000028711 ENSGGOP00000028711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]