SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028722 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028722
Domain Number 1 Region: 94-420
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.88e-68
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000000247
Further Details:      
 
Domain Number 2 Region: 423-543
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.85e-35
Family Ricin B-like 0.00000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028722   Gene: ENSGGOG00000034959   Transcript: ENSGGOT00000041110
Sequence length 561
Comment pep:known_by_projection chromosome:gorGor3.1:2b:41389338:41943366:1 gene:ENSGGOG00000034959 transcript:ENSGGOT00000041110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEM
GKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVV
IVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKII
RMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVI
SDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRN
YFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHV
INKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDL
CLDVSRLNGPVIMLKCHHMRGNQLWEYDAESCLSVNKVADGSQHPTVETCSDSTLQKWLL
RNYTRMEIFRNIFGNSTDYIL
Download sequence
Identical sequences G3SKS9
ENSGGOP00000028722 ENSGGOP00000028722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]