SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028738 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028738
Domain Number 1 Region: 288-397
Classification Level Classification E-value
Superfamily PDZ domain-like 1.28e-26
Family PDZ domain 0.0029
Further Details:      
 
Domain Number 2 Region: 408-520
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-25
Family PDZ domain 0.0000057
Further Details:      
 
Domain Number 3 Region: 109-218
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-17
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028738   Gene: ENSGGOG00000034911   Transcript: ENSGGOT00000041055
Sequence length 1131
Comment pep:known_by_projection chromosome:gorGor3.1:2b:93540463:94191405:1 gene:ENSGGOG00000034911 transcript:ENSGGOT00000041055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIAVFEEQEPLHKIESPSGNPADRQSPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTP
LLVRRSSDPVPGPPADTQPSASHPGGQSLKPVVPDSTQNLEDREVLNGVQTELLTSPKTK
DTLSDMTRTVEISGEGGPLGIHVVPFFSSLSGRILGLFIRGIEENSRSKREGLFHENECI
VKINNVDLVDKTFAQAQDVFRQAMKSASVLLHVLPPQNREQYEKSVIGSLNIFGNNDGVL
KTKVPPPVHGKSGLKTANLTGTDSPETDASASLQQNKSPRVPRLGGKPSSPSLSPLMGFG
SKKNAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGAAIKDGRLQSGDRIL
EVNGRDVTGRTQEELVAMLRSTKQGEIASLVIARQEGHFLPRELKGEPDCCALSLETSEQ
LTFEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVN
GESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPAECGAFSKPCFENSQ
NAVTTSRRNDNSILHALGTYSPQDKQKDLLLPNDGWAESEVPPSPTPHSALELGLEDYSH
SSGVDSAVYFPDQHINFRSVTPARQPESINLKASKSMDLVPDESKVHSLAGQKSESPSKD
FGPTLGLKKSSSLESLQTAVAEVRKNDLPFHRPRPHMVRGRGCNESFRAAIDKSYDGPEE
IEADGLSDKSSHSGQGALNCESAPQGNSELEDMENKARKVKKTKEKEKKKEKGKLKVKEK
KRKEENEDPERKIKKKGFGAMLRFGKKKEDKGGKAEQKGTLKHGGLREEELEKMKEERER
IGAKHQELREKQARGLLDYATGAIGSVYDMDDDEMDPNYARVNHFREPCTSANVFRSPSP
PRAGPFGYPRDGRPLSPERDHLEGLYAKVNKPYHPLVPADSGRPTGGSTDRIQKLRKEYY
QARREGFPLYEDDDGRARPSEYDLLWVPGKGPDGNAHNLRFEGMERQYASLPRGGPADPV
DYLPAAPRGLYKERELPYYPGAHPMHPPKGSYPRPTELRVADLRYPQHYPPPPAPQHKGP
FRQDVPPSPPQHQRMPAYQETGRPGPRGGSPDQYPYRTQDSRQKNPMTAAV
Download sequence
Identical sequences ENSGGOP00000028738 ENSGGOP00000028738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]