SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028742 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028742
Domain Number 1 Region: 64-292,438-543
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-39
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 2 Region: 429-549,750-785,818-868,947-1013
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000977
Family WD40-repeat 0.02
Further Details:      
 
Domain Number 3 Region: 1122-1178
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000136
Family SNARE fusion complex 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028742   Gene: ENSGGOG00000034916   Transcript: ENSGGOT00000041039
Sequence length 1186
Comment pep:known_by_projection chromosome:gorGor3.1:3:120525118:121029086:1 gene:ENSGGOG00000034916 transcript:ENSGGOT00000041039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKFNFRKVLDGLTASSPGSGSSSGSNSGGGAGSGSVHPAGTAGVLREEIQETLTSEYFQ
ICKTVRHGFPHQPTALAFDPVQKILAIGTRTGAIRILGRPGVDCYCQHESGAAVLQLQFL
INEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLYVGTERGNTH
IVNIESFILSGYVIMWNKAIELSTKTHPGPVVHLSDSPRDEGKLLIGYENGTVVFWDLKS
KRAELRVYYDEAIHSIDWHHEGKQFMCSHSDGSLTLWNLKSPSRPFQTTIPHGKSQREGR
KSESCKPILKVEYKTCKNSEPFIIFSGGLSYDKACRRPSLTIMHGKAITVLEMDHPIVEF
LTLCETPYPNEFQEPYAVVVLLEKDLIVVDLTQSNFPIFENPYPMDIHESPVTCTAYFAD
CPPDLILVLYSIGVKHKKQGYSNKEWPISGGAWNLGAQTYPEIIITGHADGSIKFWDASA
ITLQMLYKLKTSKVFEKQKVGEGKQTCEIVEEDPFAIQMIYWCPESRIFCVSGVSAYVII
YKFSRHEITTEIVSLEVRLQYDVEDIITPEPETSPPFPDLSAQLPSSRSLSGSTNTVASE
GVTKDSIPCLNVKTRPVRMPPGYQAELVIQLVWVDGEPPQQITSLAVSSAYGIVAFGNCN
GLAVVDFIQKTVLLSMGTIDLYRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFYPDLTK
RIRTSYQSLTELNDSPVPLELERCKSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNR
WGPGRPPFRKAQSAACMEISLPVTTEENRENSYNRSRSSSISSIDKDSKEAITALYFMDS
FARKNDSTISPCLFVGTSLGMVLIISLNLPLADEQRFTEPVMVFPSGTFLSLKGAVLTFS
CMDQMGGLMQPPYEVWRDPNNIDENEKSWRRKVVMNSSSASEEIGDHQYTIICSEKQAKV
FSLPSQTCLYVHNITETSFILQANVVVMCSSACLACFCANGHIMIMSLPSLRPMLDVNYL
PLTDMRIARTFCFTNEGQALYLVSPTEIQRLTYSQEMCDNLQDMLGDLFTPIETPEAQNR
GFLKGLFGGSGQTFDREELFGEASAGKASRSLAQHIPGPGSIEGMKGAAGGVMGELTRAR
IALDERGQRLGELEEKTAGMMTSAEAFSKHAHELMLKYKDKKWYQF
Download sequence
Identical sequences G3SKU9
ENSGGOP00000028742 XP_018880273.1.27298 ENSGGOP00000028742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]