SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028744 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028744
Domain Number 1 Region: 130-455
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.56e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000181
Further Details:      
 
Domain Number 2 Region: 460-596
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.4e-23
Family Ricin B-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028744   Gene: ENSGGOG00000034941   Transcript: ENSGGOT00000040976
Sequence length 603
Comment pep:known_by_projection chromosome:gorGor3.1:12:132328713:132453525:-1 gene:ENSGGOG00000034941 transcript:ENSGGOT00000040976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVARKIRTLLTVNILVFVGIVLFSVYCRLQGRSQELVRIVSGDRRVRSRHAKVGALGDR
EAILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGLAATLRDEGQEAEGKYEEYGYN
AQLSDRISLDRSIPDYRPRKCRQMSYAQDLPQVSVVFIFVNEALSVILRSVHSVVNHTPS
QLLKEVILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKAATAPV
VGFFDAHVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYSTFEVQQYANAAHGYNWGLWC
MYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELGMRV
WQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPM
TNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRIYNNTLTYGEVRNSKASGYCLDQ
GAEDGDRAILYPCHGMSSQLVRYSADGLLQLGPLGSTAFLPDSKCLVDDGRGRMPTLKKC
EDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKH
ARH
Download sequence
Identical sequences G3SKV1
XP_018894700.1.27298 ENSGGOP00000028744 ENSGGOP00000028744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]