SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028758 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028758
Domain Number 1 Region: 3-391
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.44e-126
Family Motor proteins 0.00000000303
Further Details:      
 
Domain Number 2 Region: 450-554
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.45e-24
Family FHA domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028758   Gene: ENSGGOG00000034900   Transcript: ENSGGOT00000041081
Sequence length 1392
Comment pep:known_by_projection chromosome:gorGor3.1:20:16730021:16936734:-1 gene:ENSGGOG00000034900 transcript:ENSGGOT00000041081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVKVAVRVRPMNRREKDLEAKFIIQMEKSKTTITNLKIPEGGTGDSGRERTKTFTYDF
SFYSADTKSPDYVSQEMVFKTLGTDVVKSAFEGYNACVFAYGQTGSGKSYTMMGNSGDSG
LIPRICEGLFSRINETTRWDEASFRTEVSYLEIYNERVRDLLRRKSSKTFNLRVREHPKE
GPYVEDLSKHLVQNYGDVEELMDAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFDSEM
PCETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISALADLSQDAANTL
AKKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIIN
KPTINEDANVKLIRELRAEIARLKTLLAQGNQIALLDSPTALSMEEKLQQNEARVSDTLT
YIFNNLFFFFSSFQEQTLALRKEGIGVVLDSELPHLIGIDDDLLSTGIILYHLKEGQTYV
GRDDASTEQDIVLHGLDLESEHCIFENIGGTVTLIPLSGSQCSVNGVQIVEATHLNQGAV
ILLGRTNMFRFNHPKEAAKLREKRKSGLLSSFSLSMTDLSKSRENLSAVMLYNPGLEFER
QQREELEKLESKRKLIEEMEEKQKSDKAELERMQQEVETQRKETEIVQLQIRKQEESLKR
RSFHIENKLKDLLAEKEKFEEERLREQQEIELQKKRQEEETFLRVQEELQRLKELNNNEK
AEKFQIFQELDRLQKEKDEQYAKLELEKKRLEEQEKEQVMLVAHLEEQLREKQEMIQLLR
RGEVQWVEEEKRDLEGIRESLLRVKEARAGGDEDGEELEKAQLRFFEFKRRQLVKLVNLE
KDLVQQKDLLKKEVQEEQEILECLKCEHDKESRLLEKHDESVTNVTEVAQDFEKIKPVEY
RLQYKERQLQYLLQNHLPTLLEEKQRAFEILDGGPLSLDNTLYQVEKEMEEKEEQLAQYQ
ANASQLQKLQATFEFTANIARQEEKVRKKEKEILESREKQQREALEQALARLERRHSALQ
RRSTLGMEIEEQRQKLASLNSGSREQSGLQASLEAEQEALEKDQERLKYEIQQLKQKIYE
VDGVQKGHHGTLEGKVASSSLPVSAEKSHLVPLMDARINAYIEEEVQRRLQDLHCVISEG
CSTSADTMKDNEKLHNGTIQRKLKYELCRDLLCVLMPEPVATACANHPLLQQDLVQLSLD
WKTEIPDLVLPNGVQVSSKFQTTLVDMIYFLHGNMEVNVPSLAEVQLLLYTTVKVMGESG
HDQCQSLVLLNTHIALVKEDCVFYPRTRSRNIPPPGAQFDVIKCHALSEFGCVVVPEKKN
VSTVELVFLQKLKPSVGSRNSPPEHLQEAPDVQLFTTPLYLQGSQNVTPEVWKLTFNSQD
EALWLISHLTRL
Download sequence
Identical sequences ENSGGOP00000028758 ENSGGOP00000028758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]