SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000014 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000014
Domain Number 1 Region: 333-387
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000795
Family RING finger domain, C3HC4 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000014   Gene: ENSGGOG00000000014   Transcript: ENSGGOT00000000014
Sequence length 393
Comment pep:known_by_projection chromosome:gorGor3.1:5:162700664:162718132:1 gene:ENSGGOG00000000014 transcript:ENSGGOT00000000014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQCACVERELDKVLQKFLTYGQHCEQSLEELLHYVGQLRAELASAALQGTPLSATLSLV
MSQCCRKIKDTVQKLASDHKDIHSSVSRVGKAIDRNFDSEICGVVSDAVWDAREQQQQIL
QMAIVEHLYQQGMLSVAEELCQESTLNVDLDFKQPFLELNRILEALHEQDLGPALEWAVS
HRQRLLELNSSLEFKLHRLHFIRLLAGGPAKQLEALSYARHFQPFARLHQREIQVMMGSL
VYLRLGLEKSPYCHLLDSSHWAEICETFTRDACSLLGLSVESPLSVSFASGCVALPVLMN
IKAVIEQRQCTGVWNHKDELPIEIELGMKCWYHSVFACPILRQQTSDSNPPIKLICGHVI
SRDALNKLINGGKLKCPYCPMEQNPADGKRIIF
Download sequence
Identical sequences G3QCR9 H2QS45
ENSGGOP00000000014 ENSPTRP00000030056 XP_003805417.1.60992 XP_004043163.1.27298 XP_008968742.1.60992 XP_009448536.1.37143 XP_018882516.1.27298 XP_018882517.1.27298 ENSPTRP00000030056 ENSGGOP00000000014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]