SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000080 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000080
Domain Number 1 Region: 414-475
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000141
Family LIM domain 0.0026
Further Details:      
 
Domain Number 2 Region: 472-542
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000846
Family LIM domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000080
Domain Number - Region: 384-417
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0891
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000080   Gene: ENSGGOG00000000081   Transcript: ENSGGOT00000000081
Sequence length 574
Comment pep:known_by_projection chromosome:gorGor3.1:7:141877762:141887604:1 gene:ENSGGOG00000000081 transcript:ENSGGOT00000000081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRV
GEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPP
LEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATP
FSSMSSIKPAAGGTAPLPPWKSPSSSQPLPQVPVPAPAQSQTQFHVQPQPQPKPQVQLHV
QSQPQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGH
PEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEE
LEQLTQQLMQDMEHPQRQNVAVNELCGQCHQPLARAQPAVRALGQLFHIACFTCHQCAQQ
LQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLE
GTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCE
DCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT
Download sequence
Identical sequences ENSGGOP00000000080 ENSGGOP00000000080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]