SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000293 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000293
Domain Number 1 Region: 628-682
Classification Level Classification E-value
Superfamily RING/U-box 0.0000138
Family RING finger domain, C3HC4 0.065
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000293
Domain Number - Region: 508-539
Classification Level Classification E-value
Superfamily F-box domain 0.000458
Family F-box domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000293   Gene: ENSGGOG00000000296   Transcript: ENSGGOT00000000299
Sequence length 708
Comment pep:known_by_projection chromosome:gorGor3.1:8:99263395:99275722:-1 gene:ENSGGOG00000000296 transcript:ENSGGOT00000000299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFKDKDERISCLEAYVILTSKSSRFTDETEILKMSQRHSGQAGTEAGNGADSPLIVNSK
YSTFRDFRSTSSFQDSGYNELKSCSFDNIDKEYLGKKEKGPTLLYEHPETSGLGLTHPLE
SPTQKKKCILPRKEKDKTPELCETPKISGKKCLPRRRLNVSFALLKGDFESQNSSLESSI
SQVINLEKNIPSSASGFSRANNFSPLVTSTLKTEEVTSCSQKLRLNFSQQKTSTIDDSKH
DCSLFEVECISPIQGNNFKDSITHDFSDSSLCINDENACPELLGSSVSGTTCGTDEDIFV
TPISNLVANIRFNTSQILSPSPEVRGSISTPEDSGFNSLSLEKSEDSLSDQEGSFQELLQ
KHKGTSKVGDTIRKTRHLGRSRRLSTLREQSSQSETEEEKQIVHPDSEKRAAAASAISEG
QLSSDESGDLTFSLKNLSKTPALQLVHELLMKSKRKRLQENSGHEFLEQGDGEKIAVLQC
ILAGLIGKKMGIEKLDILTELKYRNLKHILAMVLESLTAESLCSVWKVSRNWREIVVQDK
NANRRRKFYITQLKTDSEGAVLNVEDAATRLQLLNRSALRSVQAQARIPGSQREQGSTLS
PWGEVLTPLASSSVTHLSSKQEEYVKVAKTLFTDEALKPCPRCQSPAKYQPYKKRGLCSR
TACGFDFCVLCLCAYHGSEECSRGAAKPRNRKDTLPGSAQSKRNLKRL
Download sequence
Identical sequences G3QDH4
ENSGGOP00000000293 ENSGGOP00000000293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]