SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000332 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000332
Domain Number 1 Region: 635-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 579-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 103-162
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.09e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 677-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 457-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 270-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 541-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 308-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000156
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 381-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000445
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 488-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000219
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000332   Gene: ENSGGOG00000000337   Transcript: ENSGGOT00000000340
Sequence length 738
Comment pep:known_by_projection chromosome:gorGor3.1:19:53990754:54018087:-1 gene:ENSGGOG00000000337 transcript:ENSGGOT00000000340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLVNALSGGGQEVKPEGKCAHNGMCFRCEEVAPDTCEGYRYPGLVVSVAGKEGPNPDH
KSGFLDLAQEGIQALPYQLSAHLSVWILTGEERMPSARGKSKSKAPITFGDLAIYFSQEE
WEWLSPIQKDLYEDVMLENYRNLVSLGLSFRRPNVITLLEKGKAPWMVEPVRRRRAPELV
TVALFNSFGEVMFSRMVLMLMDVCQYLVIDELDLGSKCETKKLPPNQCNKSGQSICQKLV
SAQQKAPTRKSGCNKNSVLIKPKKGHSGKKPLKCNDCGKTFSRSFSLKLHQNIHTGEKPF
ECSNCRKAFRQISSILLHQRIHSGKKSHECSKCGESFNQRTTLILHMRIHDGKEILDYGK
ALSQCQSFNIQQKIHVVGNVCQCRKCGKAFSQMSSLLLHKKIHNGKKTHKYNKCGRGIKK
KSVFVVHKRIHAGEKIPENAKALSQSLQQRSHHLENPFKCRKCGKLFNRVSPLMLHQRIH
TSEKPYKCDKCDKFFRRLSTLILHLRIHNGEKLYRCNKCEKVCNRHSSLIQHQKVHTKKK
KLFECKECGKMFSGTANLKIHQNIHSEEKPFKCNKCSKVFGRQSFLIEHQRIHTGEKPYQ
CEECGKAFSHRISLTRHKRIHTEDRPYECDQCGKAFSQSAHLAQHERIHTGEKPYTCKTC
GKAFSQRTSLILHERSHTGEKPYECNECGKAFSSGSDLIRHQRSHSSEKPYECSKCGKAY
SRSSSLIRHQNTHSEEKA
Download sequence
Identical sequences ENSGGOP00000000332 ENSGGOP00000000332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]