SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000364 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000364
Domain Number 1 Region: 29-163
Classification Level Classification E-value
Superfamily Cupredoxins 2.43e-52
Family Ephrin ectodomain 0.0000000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000364   Gene: ENSGGOG00000000371   Transcript: ENSGGOT00000000373
Sequence length 228
Comment pep:known_by_projection chromosome:gorGor3.1:5:90253162:90548070:-1 gene:ENSGGOG00000000371 transcript:ENSGGOT00000000373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
Download sequence
Identical sequences A0A2K5QSZ4 A0A2K6GUL2 A0A2K6V1M4 G1RK43 G3QDP0 H0VEU0 H2PG80 H2QRA5 P52803
9598.ENSPTRP00000029298 9600.ENSPPYP00000017522 9606.ENSP00000328777 NP_001953.1.87134 NP_001953.1.92137 XP_002815814.1.23681 XP_003259858.1.23891 XP_003463586.1.53824 XP_003788975.1.62490 XP_003826809.1.60992 XP_003920760.1.74449 XP_003981221.1.62641 XP_004393840.1.74151 XP_004420385.1.5094 XP_004778320.1.14098 XP_008504839.1.77740 XP_010606898.1.5607 XP_012502824.1.63892 XP_014708463.1.49734 XP_017382725.1.71028 XP_018884018.1.27298 XP_019306080.1.44245 XP_021557182.1.83697 XP_526972.2.37143 ENSPPYP00000017522 ENSPTRP00000029298 ENSPTRP00000029298 ENSP00000328777 gi|4503487|ref|NP_001953.1| ENSP00000328777 ENSNLEP00000013600 ENSP00000328777 ENSPPYP00000017522 ENSNLEP00000013600 ENSGGOP00000000364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]