SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000485 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000485
Domain Number 1 Region: 118-180
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.71e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000485   Gene: ENSGGOG00000000493   Transcript: ENSGGOT00000000497
Sequence length 382
Comment pep:known_by_projection chromosome:gorGor3.1:5:44550099:44554239:1 gene:ENSGGOG00000000493 transcript:ENSGGOT00000000497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPL
RGEEGTEATLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK
LRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSG
KRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYP
YPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLS
PPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLS
YDMHLHHDRGPMYEELNAFFHN
Download sequence
Identical sequences A0A2I3TJA7 G3SDZ7 Q15784
ENSP00000306754 ENSP00000306754 ENSGGOP00000000485 ENSGGOP00000000485 9606.ENSP00000306754 ENSP00000306754 NP_006151.3.87134 NP_006151.3.92137 XP_004041860.1.27298 XP_009430550.2.37143 XP_511456.3.37143 gi|98986461|ref|NP_006151.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]