SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000590 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000590
Domain Number 1 Region: 385-398,429-635
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 8.68e-37
Family Cofactor-dependent phosphoglycerate mutase 0.024
Further Details:      
 
Domain Number 2 Region: 14-88
Classification Level Classification E-value
Superfamily UBA-like 1.66e-16
Family UBA domain 0.00056
Further Details:      
 
Domain Number 3 Region: 257-321
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000614
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000590
Domain Number - Region: 93-220
Classification Level Classification E-value
Superfamily LigT-like 0.00022
Family Atu0111-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000590   Gene: ENSGGOG00000000599   Transcript: ENSGGOT00000000604
Sequence length 649
Comment pep:known_by_projection chromosome:gorGor3.1:11:120729461:120903565:1 gene:ENSGGOG00000000599 transcript:ENSGGOT00000000604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALAS
TGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKA
HNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKED
SAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGC
DWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS
LTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGET
TPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHN
ILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPVSKL
VVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ
MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
Download sequence
Identical sequences A0A2I2YTZ9 A0A2I3RYA9 A0A2J8X0C0
ENSPTRP00000007535 9598.ENSPTRP00000007535 ENSGGOP00000000590 ENSPTRP00000007535 XP_003820018.1.60992 XP_004052351.1.27298 XP_508828.2.37143 ENSGGOP00000000590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]