SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000601 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000601
Domain Number 1 Region: 317-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-109
Family STAT DNA-binding domain 0.000000000254
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 9.42e-66
Family STAT 0.00000000861
Further Details:      
 
Domain Number 3 Region: 569-710
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-44
Family SH2 domain 0.0000000878
Further Details:      
 
Domain Number 4 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 3.66e-44
Family Transcription factor STAT-4 N-domain 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000601   Gene: ENSGGOG00000000611   Transcript: ENSGGOT00000000615
Sequence length 754
Comment pep:known_by_projection chromosome:gorGor3.1:2b:79208875:79258664:-1 gene:ENSGGOG00000000611 transcript:ENSGGOT00000000615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMVSTTAGLC
Download sequence
Identical sequences ENSGGOP00000000601 ENSGGOP00000026987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]