SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000613 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000613
Domain Number 1 Region: 25-214
Classification Level Classification E-value
Superfamily Cupredoxins 1.07e-57
Family Multidomain cupredoxins 0.0000034
Further Details:      
 
Domain Number 2 Region: 378-578
Classification Level Classification E-value
Superfamily Cupredoxins 1.06e-52
Family Multidomain cupredoxins 0.00000369
Further Details:      
 
Domain Number 3 Region: 223-367
Classification Level Classification E-value
Superfamily Cupredoxins 6.42e-49
Family Multidomain cupredoxins 0.00000856
Further Details:      
 
Domain Number 4 Region: 736-916
Classification Level Classification E-value
Superfamily Cupredoxins 2.01e-46
Family Multidomain cupredoxins 0.0000042
Further Details:      
 
Domain Number 5 Region: 923-1069
Classification Level Classification E-value
Superfamily Cupredoxins 1.92e-44
Family Multidomain cupredoxins 0.00000472
Further Details:      
 
Domain Number 6 Region: 581-725
Classification Level Classification E-value
Superfamily Cupredoxins 6.2e-42
Family Multidomain cupredoxins 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000613   Gene: ENSGGOG00000000624   Transcript: ENSGGOT00000000628
Sequence length 1071
Comment pep:known_by_projection chromosome:gorGor3.1:11:91340876:91436145:1 gene:ENSGGOG00000000624 transcript:ENSGGOT00000000628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKQPAGCIFLLTFLGLSGLVGTVTRTYYIGIVEEYWNYVPQGKNVITGKSFTEDKLAT
LFLERGPNRIGSIYKKAVYRRFTDGTYSIEIPKPPWLGFLGPILRAEVGDVIIIHLKNFA
SRPYSLHPHGVFYNKDSEEGALYPDATSGRNKNDDMVPPGKNYTYVWPVREEYAPTPADA
NCLTWVYHSHIDAPKDICSGLIGPLLVCKEGILNRYSGTRNDVDQEFVIMFTLVDENQSW
YLNENIKHFCTDPDSVDKKDAVFQRSNKMHALNGYLFGNFPEPDMCVGESVSWHLFGMGN
EIDIHSIYFYGNTFISRGHRTDVVNLFPATFLTTEMIAENPGKWMITCQVSDHLQAGMLG
QYNVDNCKSDIFYPKMKGQQRRYFIAAEKILWDYAPQGYNKFSGLPLNASGSDSDLYFTQ
GDNRIGGKYWKVRYTEFVDATFTKRKRLSAEEAHLGILGPVIKAEVGDTLLVTFANKADK
VYSILPHGVIYDKASDAAPNLDGKSHSGFVKPGAHVKPGETFTYKWTVPESVSPTAGDPP
CLTYLYFSAVDPIKDTSSGLVGPLLVCKKGVLNADGTQKGIDKEFYLLFTVFDENLSRYF
DENIQKFIWHPFSIDKEDKEFVKSNRMHAVNGYMYGNQPGLNMCKRDRVSWHLIGLGTDT
DMHGIVFQGNTIHLRGTHRDSLALFPHMATTAFMQPDHAGIFRVFCATMPHLSRGMGQIY
EVSSCDNRDPSEQRYGMIRTFYIAAEEVEWDYAPNKNWEFEKQHVDARGERHGDIFMNRT
ENWIGSQYKKVVYREYTDGEFVEIKARPPREEHLELLGPMIHAEVGNTVLIIFKNKASRP
YSISAQGVEEMDSEKTMIITGEVKTYRWNIPKRSGPGPSDPNCIPWVYYSTVNFVKDTYS
GLMGPLITCRKGVLNEKGRRSDVDYEFALLFLVFNENESWYLDDNIKKYLNKDPRDFKRT
EDFEESNRMHAINGKIFGNLHGLIMNEDTMTNWYLLGIGSEVDIHTIHYHAESFLFKIDK
SYREDVYDLFPGTFQTIELFADHPGTWLLHCHVSDHIHAGMETTYTVLRNI
Download sequence
Identical sequences ENSGGOP00000000613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]