SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000629 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000629
Domain Number 1 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.68e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 449-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000629   Gene: ENSGGOG00000000639   Transcript: ENSGGOT00000000644
Sequence length 544
Comment pep:known_by_projection chromosome:gorGor3.1:19:56040782:56043661:1 gene:ENSGGOG00000000639 transcript:ENSGGOT00000000644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFEDVAVYFSQEEWGLLDTAQRALYRHVMLENFTLVTSLGLSTSRPRVVIQLERGEEPW
VPSGKDMTLARNTYGRLNSGSWSLTEDGDVSGEWPRAFPDTPPGMTTSVFPVADACHSVK
SLQRQPGASPSQERKPTGVSVIYWERLLLGSRSDQASISLRLTSPLRPPKSSRPREKTFT
EYRVPGRQPRTPERQKPCAQEVPGRAFGNASDLKAASGGRDRRMGAALQEPHRLLGGQEP
STWDELGEALPAGEKSFECRACSKVFVKSSDLLKHLRTHTGERPYECAQCGKAFSQTSHL
TQHQRIHSGETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCSECGKAFSHGSNLSQHR
KIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCALCGAAFSQGSSLFLHQRVHT
GEKPFACAQCGRSFSRSSNLTQHQLLHTGERPFRCVDCGKGFAKGAVLLSHRRIHTGEKP
FVCTQCGRAFRERPALLHHQRIHTPEKTDAAAPDCTPGPGFLQGHHRKVRRGGKPSPVLK
PAKV
Download sequence
Identical sequences G3RVF8
XP_004061658.1.27298 ENSGGOP00000000629 ENSGGOP00000000629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]