SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000640 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000640
Domain Number 1 Region: 153-297
Classification Level Classification E-value
Superfamily SH2 domain 1.28e-40
Family SH2 domain 0.00000613
Further Details:      
 
Domain Number 2 Region: 81-204
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-27
Family SH3-domain 0.0000683
Further Details:      
 
Domain Number 3 Region: 268-390
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000152
Family Protein kinases, catalytic subunit 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000640   Gene: ENSGGOG00000000651   Transcript: ENSGGOT00000000656
Sequence length 400
Comment pep:known_by_projection chromosome:gorGor3.1:18:697396:726790:-1 gene:ENSGGOG00000000651 transcript:ENSGGOT00000000656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI
INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG
IFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLSLLDFLKEGDGKYLKLPQLVDMAAQMVNREVLEQVERGYRMPCPQGCPESLHE
LMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences ENSGGOP00000000640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]